PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5BS_FC54F9BEA.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 265aa    MW: 28098.5 Da    PI: 6.2237
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5BS_FC54F9BEA.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.24e-0988134652
                            HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                            + rr   NR A r++R++Kka ++ Lee+v +L+a Nk+L k+l++ 
  Traes_5BS_FC54F9BEA.1  88 KKRRPSGNRAAVRKYREKKKAHTALLEEEVVQLKALNKQLLKKLQNH 134
                            5677778**********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.6E-1379151No hitNo description
SMARTSM003383.1E-883150IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.51985132IPR004827Basic-leucine zipper domain
PfamPF077164.1E-1486140IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-787134No hitNo description
CDDcd146861.35E-1188133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MDDGDLDFSN PEAYLCSDTG AGCSMDSYFD GILNDAEHLA CTHTHTCNPP VDDSSHTHTC  60
VHVHTKIVSA SSDGGAADSP AENSGASKKR RPSGNRAAVR KYREKKKAHT ALLEEEVVQL  120
KALNKQLLKK LQNHAALEAE AARLRCLLVD VRGRIDGEIG AFPYQRPVKN VDLVSGVDQG  180
GFLGSAQVMN SCDFRCNDQM YCNPGMQMRT IGDDGAMSGQ VFGQGTGDIA NIQCMGGAKS  240
GLTMPPGCGG MGTMPSGCLP SSEKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003563276.11e-154PREDICTED: uncharacterized protein LOC100823660
SwissprotQ8VY766e-74BZP19_ARATH; Basic leucine zipper 19
TrEMBLW5FPL90.0W5FPL9_WHEAT; Uncharacterized protein
STRINGMLOC_60894.11e-160(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.13e-44bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]